PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_3DS_29943C262.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family Dof
Protein Properties Length: 506aa    MW: 55026.6 Da    PI: 5.7903
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_3DS_29943C262.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.61.6e-39124183261
                 zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                            ++k+++cprC+s++tkfCyynny+++qPr+fCk+C+ryWt+GG++rnvPvG+grrk+k+s
  Traes_3DS_29943C262.1 124 PDKIIPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGSMRNVPVGAGRRKSKNS 183
                            7899*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074787.0E-31121181IPR003851Zinc finger, Dof-type
PfamPF027018.6E-32126182IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.761128182IPR003851Zinc finger, Dof-type
PROSITE patternPS013610130166IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 506 aa     Download sequence    Send to blast
MMNFCRFLKA VLPWLNAHAM LVLEQHKEME DKGDSEMKVD APEEKEDSAT KGDEPRERKD  60
NEMEVDAPQA KEKAETASSS TLDHKKDDQA QISNTEEKAA SDPKEGNEKK SNDESGQDKV  120
LKKPDKIIPC PRCNSMDTKF CYYNNYNVNQ PRHFCKNCQR YWTAGGSMRN VPVGAGRRKS  180
KNSALHYRQL LMAPDCLLGS RVDISNTVNP EVLASLPSIP TQSASRSETV LKFGPEVPLC  240
ESMVSVLNIE EQNVTNAGSV PRDETREDNS CASSTTSNNG LPANAVLPGQ NGAPAYCNGV  300
GPVPQYYLGA PFMYPWSMGW NNLPVMVPGG SMPESASPSE SCSTSSAPWM NSPMMPGSRL  360
PAPPFPYPLV PPALWGCLPS WPAAAWNTPW VGTNGCISPS GSSNSSCSGN GSPTLGKHSR  420
DPNPQKDDKE EKSLWVPKTL RIDDPDEAAK SSIWATLGIK PGDPGVFKPF QFKGESKGQP  480
ADARPARALQ ANPAAFSRLQ SFQESS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703060.0HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003565622.20.0PREDICTED: cyclic dof factor 2-like
TrEMBLW5DG260.0W5DG26_WHEAT; Uncharacterized protein
STRINGMLOC_56598.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP143438116
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.22e-66cycling DOF factor 2
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]